AV43534

Anti-AADAT antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-kynurenine aminotransferase II, Anti-Aminoadipate aminotransferase, Anti-KAT2, Anti-KATII
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 47 kDa
• Espèces réactives: rabbit, human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_872603
• Numéro d'accès UniProt: Q8N5Z0
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... AADAT(51166)

Description

Description générale

KAT (kynurenine aminotransferase, AADAT) II, a pyridoxal 5′-phosphate-dependent enzyme, is the primary enzyme in the brain for catalyzing the transamination of kynurenine to KγNA (kynurenic acid) and the transmination of aminoadipate to α-oxoadipate. Kynurenic acid, a neuroprotective compound, is an endogenous antagonist of ionotropic excitatory amino acid receptors in the central nervous system.

Spécificité

Anti-AADAT polyclonal antibody (Anti-KAT-II) reacts with a sequence of the enzyme human aminoadipate aminotransferase (kynurenine aminotransferase II, hAADAT, KAT-II).

Immunogène

Synthetic peptide directed towards the N terminal region of human AADAT

Application

Anti-kynurenine aminotransferase II (anti-Aminoadipate aminotransferase; anti-AADAT) is a rabbit IgG polyclonal antibody used to tag kynurenine aminotransferase protein for detection and quantitation by Western blotting and in tissues by immunohistochemical (IHC) techniques. Selective KAT II inhibition may be an important pharmacological tool, since it would reduce KγNA formation without causing complete depletion of this neuroprotector.

Actions biochimiques/physiologiques

AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties.This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Two alternative transcripts encoding the same isoform have been identified, however, additional alternative transcripts and isoforms may exist.

Séquence

Synthetic peptide located within the following region: AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 12 - Non Combustible Liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable