Skip to Content
Merck
All Photos(5)

Key Documents

HPA010793

Sigma-Aldrich

Anti-B4GALT3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-β-1,4-GalTase 3 antibody produced in rabbit, Anti-β-1,4-Galactosyltransferase 3 antibody produced in rabbit, Anti-β4Gal-T3 antibody produced in rabbit, Anti-UDP-Gal:β-GlcNAc β-1,4-galactosyltransferase 3 antibody produced in rabbit, Anti-UDP-galactose:β-N-acetylglucosamine β-1,4-galactosyltransferase 3 antibody produced in rabbit, Anti-b4Gal-T3 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€540.00

€540.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€540.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

€540.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, mouse

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... B4GALT3(8703)

General description

B4GALT3 (UDP-Gal:βGlcNAc β 1,4- galactosyltransferase, polypeptide 3) belongs to a family of seven members, called β-1,4-galactosyltransferase (β-1,4-GalT). It is expressed in a wide range of human tissues. Its expression in fetal brain is much higher than that in adult brain. This gene is located on human chromosome 1q23. The coding region of this gene consists of one initiation codon, preceding a sequence coding for a putative hydrophobic transmembrane region. The predicted encoded protein is a type II transmembrane protein, containing a cytoplasmic N-terminal of four residues. It has a stem region, an eighteen residue transmembrane region, and a catalytic domain made of 371 amino acids, containing four potential N-linked glycosylation sites.

Immunogen

β-1,4-Galactosyltransferase 3 recombinant protein epitope signature tag (PrEST)

Application

Anti-B4GALT3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

B4GALT3 (UDP-Gal:βGlcNAc β 1,4- galactosyltransferase, polypeptide 3) enzyme catalyzes the synthesis of poly-N-acetyllactosamine. However, its extension capacity of poly-N-acetyllactosamine is poor, and it adds the first galactose residue to poly-N-acetyllactosamine chain. It enhances metastasis and invasiveness of neuroblastoma cells, via the modulation of signaling and glycosylation of β1-integrin. It is overexpressed in neuroblastoma cells, and predicts poor prognosis for the same. B4GALT3 expression is also negatively correlated with metastasis in colorectal cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72092

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Chia-Hua Chen et al.
Carcinogenesis, 35(6), 1258-1266 (2014-01-10)
Metastasis often occurs in colorectal cancer (CRC) patients and is the main difficulty in cancer treatment. The upregulation of poly-N-acetyllactosamine-related glycosylation is found in CRC patients and is associated with progression and metastasis in cancer. β-1,4-Galactosyltransferase III (B4GALT3) is an
Hsiu-Hao Chang et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 19(7), 1705-1716 (2013-02-28)
Neuroblastoma (NB) is a neural crest-derived tumor that commonly occurs in childhood. β-1,4-Galactosyltransferase III (B4GALT3) is highly expressed in human fetal brain and is responsible for the generation of poly-N-acetyllactosamine, which plays a critical role in tumor progression. We therefore
R Almeida et al.
The Journal of biological chemistry, 272(51), 31979-31991 (1998-01-24)
BLAST analysis of expressed sequence tags (ESTs) using the coding sequence of the human UDP-galactose:beta-N-acetylglucosamine beta1, 4-galactosyltransferase, designated beta4Gal-T1, revealed a large number of ESTs with identical as well as similar sequences. ESTs with sequences similar to that of beta4Gal-T1
S Guo et al.
Glycobiology, 11(10), 813-820 (2001-10-06)
Several studies showed that Sf-9 cells can synthesize the galactosylated N-linked oligosaccharides if beta-1,4-galactosyltransferase (beta-1,4-GalT) is supplied. The full-length human beta-1,4-GalT I, II, III, IV, V, and VI cDNAs were independently transfected into Sf-9 cells, and the galactosylation of endogenous

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service