Mutations in NOP2/Sun domain family, member 3 (NSUN3) gene have been reported to be associated with lung cancer in non-smokers.
Immunogen
Synthetic peptide directed towards the C terminal region of human NSUN3
Application
Anti-NSUN3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
NSUN3 belongs to the methyltransferase superfamily. RsmB/NOP family. It may have S-adenosyl-L-methionine-dependent methyl-transferase activity.
Sequence
Synthetic peptide located within the following region: LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Lung cancer in never smokers would rank as the seventh most common cause of cancer death worldwide. We performed high-resolution array comparative genomic hybridization analysis of lung adenocarcinoma in sixty never smokers and identified fourteen new minimal common regions (MCR)
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
