Skip to Content
Merck
All Photos(6)

Key Documents

WH0005371M2

Sigma-Aldrich

Monoclonal Anti-PML antibody produced in mouse

clone 1D12, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-MYL, Anti-PP8675, Anti-RNF71, Anti-TRIM19, Anti-promyelocytic leukemia

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1D12, monoclonal

form

buffered aqueous solution

species reactivity

mouse, human, rat

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PML(5371)

General description

Promyelocytic leukemia (PML) is a 70 KDa protein, made of 560 amino acids.
PML is present in the nucleus. It has 9 coding exons and is mapped to human chromosome 15q24.

Immunogen

PML (AAH00080, 411 a.a. ~ 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV

Biochem/physiol Actions

Promyelocytic leukemia (PML) helps in the complete formation of the nuclear body. It can serve as a transcriptional cofactor. PML plays major roles in modulating cell morphology, proliferation and migration. It has the capability to block the ubiquitination and proteasomal degradation processes. Cytoplasmic PML is required to control TGF-β1 (transforming growth factor β 1) signaling.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Promyelocytic leukemia (PML) protein plays important roles in regulating cell adhesion, morphology, proliferation and migration.
Tang M K, et al.
PLoS ONE, 8(3), e59477-e59477 (2013)
The transcriptional role of PML and the nuclear body.
Zhong S, et al.
Nature Cell Biology, 2(5), E85-E85 (2000)
PML (promyelocytic leukemia).
Viguie F
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2000)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service