WH0004172M1

Monoclonal Anti-MCM3 antibody produced in mouse

clone 4F7, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-HCC5, Anti-MCM3 minichromosome maintenance deficient 3 (S. cerevisiae), Anti-MGC1157, Anti-P1.h, Anti-P1MCM3, Anti-RLFB
• MDL number: MFCD02263436
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4F7, monoclonal
• form: buffered aqueous solution
• species reactivity: mouse
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aλ
• GenBank accession no.: NM_002388
• UniProt accession no.: P25206
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MCM3(4172)

Description

General description

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. (provided by RefSeq)

Immunogen

MCM3 (NP_002379, 699 a.a. ~ 808 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves