HPA021818

Anti-MPP3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• Synonym(e): Anti-Discs large homolog 3, Anti-MAGUK p55 subfamily member 3, Anti-Protein MPP3
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA021818
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: recombinant expression; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: VCLVDVEPEALKQLRTSEFKPYIIFVKPAIQEKRKTPPMSPACEDTAAPFDEQQQEMAASAAFIDRHYGHLVDAVLVKEDLQGAYSQLKVVL
• UniProt-Hinterlegungsnummer: Q13368
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... MPP3(4356)

Beschreibung

Allgemeine Beschreibung

MPP3 (Membrane protein, palmitoylated 3, MAGUK p55 subfamily member 3) is a cytoplasmic protein belonging to the MAGUK family molecules. It is expressed in various tissues including normal lung cells. MPP3 is composed of a pair of Lin2/Lin7-binding (L27) domains, a PDZ domain, a Src-homology 3 (SH3) domain and a guanylate kinase homologous (GuK) domain. It exhibits high homology with Dlg in Drosophila.

Immunogen

MAGUK p55 subfamily member 3 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

MPP3 (Membrane protein, palmitoylated 3, MAGUK p55 subfamily member 3) plays an important role in the maintenance of epithelial structure through cell-cell interactions. The N-terminal domain of MPP3 binds directly to the cytoplasmic domain of CADM1 (Cell adhesion molecule 1) and forms a complex, which further connects it to the PI3K (phosphoinositide 3-kinase) for its activation. The activation of PI3K is highly required to identify the actin cytoskeleton and form epithelial cell structure. A study reports that MPP3 in conjugation with TSLC1 (tumor suppressor in lung cancer 1) shows tumor suppressive property in human lung cancer cells and any change in this interactions might lead to malignancy and tumor growth.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST75728

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable