HPA011173

Anti-SRPRB antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Protein APMCF1, Anti-SR-beta, Anti-Signal recognition particle receptor subunit beta
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA011173
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: LCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTL
• UniProt-Hinterlegungsnummer: Q9Y5M8
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SRPRB(58477)

Beschreibung

Allgemeine Beschreibung

SRPRB (signal recognition particle receptor, B subunit) is a member of the small G-protein superfamily, and was first identified in the cDNA library of breast carcinoma MCF-7 cell line. It is also a signal recognition particle receptor β (SRβ), and is made of 271 amino acids. It has a GTPase domain and resides in the cytoplasm. This gene is localized to human chromosome 3q22.2, spans 14.8kb, and contains seven exons and six introns. It has a transmembrane helix, and is expressed ubiquitously.

Immunogen

Signal recognition particle receptor subunit beta recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

The function of SRPRB (signal recognition particle receptor, B subunit) is not well characterized. Since, it is a G-protein it might be involved in multiple cellular events such as, cell division and differentiation, vesicular transport, nuclear assembly, and modulation of the cytoskeleton. It is a novel gene related to apoptosis, and is over-expressed in colon cancer. It therefore, might play a role in the control of cell cycle. It is also over-expressed in esophagus, lung, breast and liver carcinomas. It might have a role in tumorigenesis. It controls p21 and TIMP3 (TIMP metallopeptidase inhibitor 3) genes, and thus causes cell cycle arrest at the G1 phase in human hepatocellular carcinoma cells (HHCC).

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST72051

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)