HPA010023

Anti-HSPA4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-HSP70RY, Anti-Heat shock 70 kDa protein 4, Anti-Heat shock 70-related protein APG-2
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA010023
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human, mouse, rat
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: FEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDG
• UniProt-Hinterlegungsnummer: P34932
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... HSPA4(3308)

Beschreibung

Allgemeine Beschreibung

HSPA4 (heat shock protein family A (Hsp70) member 4) is a chaperone protein with an activity similar to that of Hsp110, and thus, is considered to be a member of the hsp110 protein family. It is a cytoplasmic protein and is composed of a nucleotide-binding domain (NBD) and a peptide-binding domain (PBD) intervened by a flexible linker region. In adult mouse tissues, HSPA4 mRNA has a wide range of expression with the highest expression in spleen, ovary and testis.

Immunogen

Heat shock 70 kDa protein 4 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-HSPA4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

HSPA4 (heat shock protein family A (Hsp70) member 4) is up-regulated in breast, ovarian, pancreatic and colon cancers. It plays an essential role in the migration, invasiveness and transformation of cancer cells. It is a candidate cancer stem cells (CSCs) marker for gastric cancer. This protein is induced in response to radioactive and acidic pH stress, and is up-regulated in HCC (hepatocellular carcinoma). This protein is up-regulated by NBS1 protein, which is elevated in the chromosomal-instability syndrome called Nijmegen breakage syndrome (NBS). This protein plays a critical role in normal spermatogenesis. The over-expression of HSPA4 is related with poor prognosis in HBV (hepatitis B virus)-associated early-stage HCC.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST71595

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)