WH0006924M2

Monoclonal Anti-TCEB3 antibody produced in mouse

clone 1F3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-SIII, Anti-TCEB3A, Anti-transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A)
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1F3, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_003198
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TCEB3(6924)

Descripción

General description

This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. (provided by RefSeq)

Immunogen

TCEB3 (NP_003189, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMY

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)