Saltar al contenido
Merck
Todas las fotos(2)

Key Documents

AV48972

Sigma-Aldrich

Anti-C3ORF39 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-AGO61, Anti-FLJ14566

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

66 kDa

species reactivity

human, dog, mouse, rat, horse, rabbit, guinea pig, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... C3orf39(84892)

Immunogen

Synthetic peptide directed towards the middle region of human C3orf39

Application

Anti-C3ORF39 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Biochem/physiol Actions

C3ORF39 also known as Protein O-linked mannose N-acetylglucosaminyltransferase 2 (POMGNT2; GTDC2) is a protein with glycosyltransferase activity. It is involved in the modification of O-mannosylated α-dystroglycan in the endoplasmic reticulum to generate N-acetyl glucosamine epitopes. Mutations in GTDC2 gene have been identified as the cause of Walker-Warburg syndrome.

Sequence

Synthetic peptide located within the following region: TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

M Chiara Manzini et al.
American journal of human genetics, 91(3), 541-547 (2012-09-11)
Whole-exome sequencing (WES), which analyzes the coding sequence of most annotated genes in the human genome, is an ideal approach to studying fully penetrant autosomal-recessive diseases, and it has been very powerful in identifying disease-causing mutations even when enrollment of
Mitsutaka Ogawa et al.
Biochemical and biophysical research communications, 440(1), 88-93 (2013-09-18)
Hypoglycosylation is a common characteristic of dystroglycanopathy, which is a group of congenital muscular dystrophies. More than ten genes have been implicated in α-dystroglycanopathies that are associated with the defect in the O-mannosylation pathway. One such gene is GTDC2, which
Reto Müller et al.
PloS one, 8(5), e62835-e62835 (2013-05-15)
The O-GlcNAc transferase Eogt modifies EGF repeats in proteins that transit the secretory pathway, including Dumpy and Notch. In this paper, we show that the Notch ligands Delta and Serrate are also substrates of Eogt, that mutation of a putative

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico