AV41131

Anti-RG9MTD3 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FLJ31455, Anti-RNA (guanine-9-) methyltransferase domain containing 3, Anti-RP11-3J10.9, Anti-bA3J10.9
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 36 kDa
• species reactivity: rabbit, human, dog, pig, bovine, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_659401
• UniProt accession no.: Q6PF06
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... RG9MTD3(158234)

Descripción

Immunogen

Synthetic peptide directed towards the N terminal region of human RG9MTD3

Biochem/physiol Actions

RG9MTD3 belongs to the RNA methyltransferase trmD family, TRM10 subfamily. It is a probable RNA methyltransferase.

Sequence

Synthetic peptide located within the following region: GEILATGSTAWCSKNVQRKQRHWEKIVAAKKSKRKQEKERRKANRAENPG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable